PDB entry 5hfa

View 5hfa on RCSB PDB site
Description: Crystal structure of human acetylcholinesterase in complex with paraoxon and 2-PAM
Class: hydrolase
Keywords: acetylcholinesterase, hydrolase
Deposited on 2016-01-06, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hfaa_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hfab_
  • Heterogens: NAG, FUC, DEP, EDO, FP1, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hfaA (A:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfaA (A:)
    edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
    tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
    ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
    qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
    arrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdfls
    dtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpq
    vsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayv
    fehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdp
    neprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hfaB (B:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfaB (B:)
    redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
    ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
    fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
    vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
    earrratqlahlvgcpptggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvd
    gdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvr
    vgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgar
    vyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfa
    rtgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa