PDB entry 5hf8

View 5hf8 on RCSB PDB site
Description: Crystal structure of human acetylcholinesterase in complex with paraoxon (alternative acyl loop conformation)
Class: hydrolase
Keywords: acetylcholinesterase, hydrolase
Deposited on 2016-01-06, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hf8a_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hf8b_
  • Heterogens: NAG, FUC, EFS, DEP, EDO, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hf8A (A:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hf8A (A:)
    edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
    tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
    ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
    qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
    arrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdfls
    dtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpq
    vsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayv
    fehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdp
    neprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hf8B (B:)
    gredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvd
    attfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygg
    gfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalq
    wvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgm
    gearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvp
    vvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefla
    gvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaq
    garvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywa
    nfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls
    at
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hf8B (B:)
    edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
    tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
    ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
    qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
    arrratqlahlvgcpptggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdg
    dflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrv
    gvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarv
    yayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfar
    tgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa