PDB entry 5hds

View 5hds on RCSB PDB site
Description: Femtosecond Structural Dynamics Drives the Trans/Cis Isomerization in Photoactive Yellow Protein: 3 ps Structure
Class: signaling protein
Keywords: photoreceptor cis trans isomerization trans cis isomerization free electron laser, photoreceptor, signaling protein
Deposited on 2016-01-05, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • conflict (68)
    Domains in SCOPe 2.08: d5hdsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hdsA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapxtdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv