PDB entry 5hdq

View 5hdq on RCSB PDB site
Description: MntC co-structure with mAB 305-78-7
Class: Transport protein/Immune System
Keywords: Transport protein, Monoclonal Antibody, Transport protein-Immune System complex
Deposited on 2016-01-05, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter substrate-binding protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: psaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hdqa_
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HDQ (0-219)
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HDQ (0-End)
    Domains in SCOPe 2.07: d5hdql1, d5hdql2
  • Heterogens: FE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hdqA (A:)
    mgtggkqssdksngklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdik
    kltdadvilynglnletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkq
    dphawlsldngikyvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipk
    eqramitsegafkyfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvets
    vdkkameslseetkkdifgevytdsigkegtkgdsyykmmksnietvhgsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdqA (A:)
    lkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilynglnl
    etgngwfekaleqagkslkdkkviavskdvkpiylngedkqdphawlsldngikyvktiq
    qtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafkyfskqy
    gitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseetkkdifg
    evytdsigkegtkgdsyykmmksnietvhgsmk
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5hdqL (L:)
    divmsqspsslavsvgekvtmsckssqsllyssneknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysypytfgggtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdqL (L:)
    divmsqspsslavsvgekvtmsckssqsllyssneknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysypytfgggtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrn