PDB entry 5hdo

View 5hdo on RCSB PDB site
Description: Crystal structure of a nanobody raised against urokinase-type plasminogen activator
Class: immune system
Keywords: immune system
Deposited on 2016-01-05, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-HCV NS3/4A serine protease immoglobulin heavy chain
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6YEF6 (0-End)
      • conflict (0)
      • conflict (4)
      • conflict (10)
      • conflict (26)
      • conflict (28-29)
      • conflict (32-34)
      • conflict (36)
      • conflict (46)
      • conflict (49)
      • insertion (51)
      • conflict (52)
      • conflict (54)
      • conflict (58)
      • conflict (71)
      • conflict (86-87)
      • conflict (92)
      • conflict (96-97)
      • conflict (99-100)
      • insertion (102-103)
      • conflict (104)
      • conflict (106-110)
      • conflict (121)
    Domains in SCOPe 2.07: d5hdoa_
  • Chain 'B':
    Compound: Anti-HCV NS3/4A serine protease immoglobulin heavy chain
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6YEF6 (0-126)
      • conflict (0)
      • conflict (4)
      • conflict (10)
      • conflict (26)
      • conflict (28-29)
      • conflict (32-34)
      • conflict (36)
      • conflict (46)
      • conflict (49)
      • insertion (51)
      • conflict (52)
      • conflict (54)
      • conflict (58)
      • conflict (71)
      • conflict (86-87)
      • conflict (92)
      • conflict (96-97)
      • conflict (99-100)
      • insertion (102-103)
      • conflict (104)
      • conflict (106-110)
      • conflict (121)
    Domains in SCOPe 2.07: d5hdob_
  • Chain 'C':
    Compound: Anti-HCV NS3/4A serine protease immoglobulin heavy chain
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6YEF6 (0-126)
      • conflict (0)
      • conflict (4)
      • conflict (10)
      • conflict (26)
      • conflict (28-29)
      • conflict (32-34)
      • conflict (36)
      • conflict (46)
      • conflict (49)
      • insertion (51)
      • conflict (52)
      • conflict (54)
      • conflict (58)
      • conflict (71)
      • conflict (86-87)
      • conflict (92)
      • conflict (96-97)
      • conflict (99-100)
      • insertion (102-103)
      • conflict (104)
      • conflict (109-110)
      • conflict (121)
      • expression tag (127)
    Domains in SCOPe 2.07: d5hdoc1, d5hdoc2
  • Chain 'D':
    Compound: Anti-HCV NS3/4A serine protease immoglobulin heavy chain
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6YEF6 (0-126)
      • conflict (0)
      • conflict (4)
      • conflict (10)
      • conflict (26)
      • conflict (28-29)
      • conflict (32-34)
      • conflict (36)
      • conflict (46)
      • conflict (49)
      • insertion (51)
      • conflict (52)
      • conflict (54)
      • conflict (58)
      • conflict (71)
      • conflict (86-87)
      • conflict (92)
      • conflict (96-97)
      • conflict (99-100)
      • insertion (102-103)
      • conflict (104)
      • conflict (109-110)
      • conflict (121)
    Domains in SCOPe 2.07: d5hdod_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hdoA (A:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
    tqvtvssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdoA (A:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
    tqvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hdoB (B:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
    tqvtvssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdoB (B:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
    tqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hdoC (C:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
    tqvtvssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdoC (C:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsrrrylevwgqgtqv
    tvssa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hdoD (D:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
    tqvtvssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdoD (D:)
    qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
    adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsrrrylevwgqgtqv
    tvss