PDB entry 5hdk

View 5hdk on RCSB PDB site
Description: Crystal structure of heat shock factor 2-DBD
Class: transcription
Keywords: hsf1-dbd, transcription
Deposited on 2016-01-05, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock factor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF2, HSTF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03933 (6-End)
      • expression tag (1-5)
    Domains in SCOPe 2.06: d5hdka1, d5hdka2
  • Chain 'B':
    Compound: Heat shock factor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF2, HSTF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03933 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d5hdkb1, d5hdkb2
  • Chain 'C':
    Compound: Heat shock factor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF2, HSTF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03933 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.06: d5hdkc1, d5hdkc2
  • Chain 'D':
    Compound: Heat shock factor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF2, HSTF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03933 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d5hdkd1, d5hdkd2
  • Heterogens: K, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hdkA (A:)
    hhhhhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmas
    fvrqlnmygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdkA (A:)
    hhhhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasf
    vrqlnmygfrkvvhigpvefqhpyfkqgqddllenikrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hdkB (B:)
    hhhhhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmas
    fvrqlnmygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdkB (B:)
    hhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvr
    qlnmygfrkvvhigpvefqhpyfkqgqddllenikrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hdkC (C:)
    hhhhhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmas
    fvrqlnmygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdkC (C:)
    hhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrq
    lnmygfrkvvhigpvefqhpyfkqgqddllenikrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hdkD (D:)
    hhhhhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmas
    fvrqlnmygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hdkD (D:)
    hhhvpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvr
    qlnmygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkv