PDB entry 5hd3

View 5hd3 on RCSB PDB site
Description: Femtosecond Structural Dynamics Drives the Trans/Cis Isomerization in Photoactive Yellow Protein: Dark structure of photoactive yellow protein
Class: signaling protein
Keywords: HOTORECEPTOR Trans Cis Isomerization, SIGNALING PROTEIN
Deposited on 2016-01-04, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • m (68)
    Domains in SCOPe 2.07: d5hd3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hd3A (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapxtdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv