PDB entry 5hd3

View 5hd3 on RCSB PDB site
Description: Femtosecond Structural Dynamics Drives the Trans/Cis Isomerization in Photoactive Yellow Protein: Dark structure of photoactive yellow protein
Class: signaling protein
Keywords: HOTORECEPTOR Trans Cis Isomerization, SIGNALING PROTEIN
Deposited on 2016-01-04, released 2016-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
    • modified residue (68)
  Domains in SCOPe 2.08: d5hd3a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5hd3A (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapxtdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv