PDB entry 5hcv

View 5hcv on RCSB PDB site
Description: Identification of Spirooxindole and Dibenzoxazepine Motifs as Potent Mineralocorticoid Receptor Antagonists
Class: signaling protein
Keywords: Mineralocorticoid Receptor, Ligand-binding domain, MR-LBD, Antagonists, co-crystal, SIGNALING PROTEIN
Deposited on 2016-01-04, released 2016-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (80)
    Domains in SCOPe 2.06: d5hcva_
  • Chain 'B':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (80)
    Domains in SCOPe 2.06: d5hcvb_
  • Chain 'C':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (80)
    Domains in SCOPe 2.06: d5hcvc_
  • Heterogens: 60R, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hcvA (A:)
    gshmraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvl
    pgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamye
    lcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmv
    tkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdq
    lpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hcvA (A:)
    pvmvleniepeivyagypdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitl
    iqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvr
    lqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvnsgqswqrfyqltk
    lldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hcvB (B:)
    gshmraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvl
    pgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamye
    lcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmv
    tkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdq
    lpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hcvB (B:)
    pvmvleniepeivyagypdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitl
    iqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvr
    lqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvswqrfyqltkllds
    mhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hcvC (C:)
    gshmraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvl
    pgfknlpledqitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamye
    lcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmv
    tkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdq
    lpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hcvC (C:)
    pvmvleniepeivyagypdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitl
    iqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvr
    lqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvswqrfyqltkllds
    mhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvnakplyfh