PDB entry 5hcu

View 5hcu on RCSB PDB site
Description: Crystal structure of mouse acetylchoinesterase inhibited by DFP
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-01-04, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (3-542)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5hcua1, d5hcua2
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hcub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hcuA (A:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrf
    sfvpvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisra
    qflagvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagr
    laaqgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlm
    kywtnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflp
    kll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hcuA (A:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
    dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
    rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
    rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
    artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hcuB (B:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrf
    sfvpvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisra
    qflagvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagr
    laaqgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlm
    kywtnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflp
    kll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hcuB (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
    dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
    asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
    fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
    ndprdkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll