PDB entry 5hbt

View 5hbt on RCSB PDB site
Description: Complex structure of Fab35 and human nAChR alpha1
Class: transport protein/toxin
Keywords: nicotinic acetylcholine receptor alpha1, Fab35, Complex, Myasthenia Gravis, TRANSPORT PROTEIN-TOXIN complex
Deposited on 2016-01-02, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin isoform v31
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hbta_
  • Chain 'B':
    Compound: Acetylcholine receptor subunit alpha 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA1, hCG_1811440
    Database cross-references and differences (RAF-indexed):
    • Uniprot G5E9G9 (1-211)
      • expression tag (0)
      • engineered mutation (8)
      • engineered mutation (149)
      • engineered mutation (155)
    Domains in SCOPe 2.07: d5hbtb1, d5hbtb2
  • Chain 'C':
    Compound: Fab35, Light Chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HBT (0-End)
    Domains in SCOPe 2.07: d5hbtc1, d5hbtc2
  • Chain 'D':
    Compound: Fab35, Heavy Chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HBT (0-218)
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hbtA (A:)
    ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hbtB (B:)
    ksehetrleaklfkdyssvvrpvedhrqvvevtvglqliqlinvdevnqivttnvrlkqq
    wvdynlkwnpddyggvkkihipsekiwrpdlvlynnadgdfaivkftkvllqytghitwt
    ppaifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvik
    esrgwkhsvtysccpdtpyldityhfvmqrlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hbtC (C:)
    divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
    rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelkradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hbtC (C:)
    divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
    rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelkradaaptvsifpps
    teqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstlsl
    tkadyeshnlytcevvhktssspvvksfnrne
    

  • Chain 'D':
    No sequence available.