PDB entry 5hba

View 5hba on RCSB PDB site
Description: Globular Domain of Zebrafish Complement 1qA protein
Class: immune system
Keywords: Immune system, Complement 1q
Deposited on 2015-12-31, released 2016-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Danio rerio [TaxId:7955]
    Gene: c1qa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hbaa_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Danio rerio [TaxId:7955]
    Gene: c1qa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hbab_
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Danio rerio [TaxId:7955]
    Gene: c1qa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hbac_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hbaA (A:)
    sekpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhasseg
    rlclrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagdggvgqmpk
    rlyavfngfliyrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hbaA (A:)
    ekpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhassegr
    lclrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagdggvgqmpkr
    lyavfngfliyrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hbaB (B:)
    sekpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhasseg
    rlclrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagdggvgqmpk
    rlyavfngfliyrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hbaB (B:)
    ekpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhassegr
    lclrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagmpkrlyavfn
    gfliyrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hbaC (C:)
    sekpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhasseg
    rlclrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagdggvgqmpk
    rlyavfngfliyrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hbaC (C:)
    kpafsvlrnetsqaqykqpvtfndklsdanddfqiktgyftckvpgvyyfvfhassegrl
    clrlkstsappvslsfcdfnsksvslvvsggavltllkgdkvwiepfagmpkrlyavfng
    fliyrn