PDB entry 5har

View 5har on RCSB PDB site
Description: OXA-163 beta-lactamase - S70G mutant
Class: hydrolase
Keywords: hydrolase, serine beta-lactamase
Deposited on 2015-12-30, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed):
    • Uniprot F6KZJ2 (0-236)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d5hara_
  • Heterogens: ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5harA (A:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpagtfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip