PDB entry 5h92

View 5h92 on RCSB PDB site
Description: Crystal structure of the complex between maize Sulfite Reductase and ferredoxin in the form-3 crystal
Class: oxidoreductase/electron transport
Keywords: Ferredoxin, Sulfite reductase, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2015-12-25, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfite reductase [ferredoxin], chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: SIR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sulfite reductase [ferredoxin], chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: SIR
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ferredoxin-1, chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: FDX1, PFD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h92c_
  • Heterogens: SF4, SRM, PO4, MG, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h92C (C:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h92C (C:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
    qsylddgqiadgwvltchayptsdvviethkeeelt