PDB entry 5h8x

View 5h8x on RCSB PDB site
Description: Crystal structure of the complex MMP-8/BF471 (catechol inhibitor)
Class: hydrolase
Keywords: Catechol function, MMPs, inhibitor, metalloprotese, zinc binding function, hydrolase
Deposited on 2015-12-24, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8xa_
  • Heterogens: CA, ZN, 5XT, 7FY, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h8xA (A:)
    mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
    iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
    ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg