PDB entry 5h8t

View 5h8t on RCSB PDB site
Description: Crystal structure of human cellular retinol binding protein 1 in complex with all-trans-retinol
Class: retinol-binding protein
Keywords: vitamin A, retinol, binding protein, RETINOL-BINDING PROTEIN
Deposited on 2015-12-23, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP1, CRBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09455 (Start-133)
      • expression tag (134-139)
    Domains in SCOPe 2.08: d5h8ta1, d5h8ta2
  • Heterogens: RTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5h8tA (A:)
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvqhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5h8tA (A:)
vdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrnyi
mdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemrv
egvvckqvfkkvqhhhhhh