PDB entry 5h68

View 5h68 on RCSB PDB site
Description: Crystal structure of an engaged dimer of the Geobacillus stearothermophilus SMC head domain
Class: DNA binding protein, cell cycle
Keywords: SMC protein, DNA BINDING PROTEIN, CELL CYCLE
Deposited on 2016-11-11, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosome partition protein Smc
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: smc, GT50_02560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h68a_
  • Chain 'B':
    Compound: Chromosome partition protein Smc
    Species: Geobacillus stearothermophilus 10 [TaxId:272567]
    Gene: smc, GT50_02560
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K2H586 (3-End)
      • linker (174-178)
    • Uniprot A0A0K2H586 (179-End)
      • engineered mutation (270)
    Domains in SCOPe 2.07: d5h68b_
  • Heterogens: AGS, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h68A (A:)
    gphmflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslr
    gakmedvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrq
    pcrlkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvlkgsgggsge
    emkkrflttfeqirahfgevfgelfgggradlrltdpndlletgidivaqppgkklqhls
    llsggeraltaiallfsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivi
    thrkgtmeeadvlygvtmqesgvsklvsvrledskelvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h68A (A:)
    mflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslrgak
    medvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcr
    lkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvkkrflttfeqira
    hfgevfgelfgggradlrltdpndlletgidivaqppgkklqhlsllsggeraltaiall
    fsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivithrkgtmeeadvlyg
    vtmqesgvsklvsvrledskelvrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h68B (B:)
    gphmflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslr
    gakmedvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrq
    pcrlkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvlkgsgggsge
    emkkrflttfeqirahfgevfgelfgggradlrltdpndlletgidivaqppgkklqhls
    llsggeraltaiallfsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivi
    thrkgtmeeadvlygvtmqesgvsklvsvrledskelvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h68B (B:)
    mflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslrgak
    medvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcr
    lkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvgggsgeemkkrfl
    ttfeqirahfgevfgelfgggradlrltdpndlletgidivaqppgkklqhlsllsgger
    altaiallfsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivithrkgtm
    eeadvlygvtmqesgvsklvsvrledskelvr