PDB entry 5h4c

View 5h4c on RCSB PDB site
Description: Crystal structure of Cbln4
Class: protein binding
Keywords: C1q domain, C1q/TNF superfamily, neurexin, receptor specificity, synaptogenesis, PROTEIN BINDING
Deposited on 2016-10-31, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Cbln4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cbln4, LOC499947, rCG_40881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h4ca_
  • Chain 'B':
    Compound: Protein Cbln4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cbln4, LOC499947, rCG_40881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h4cb_
  • Chain 'C':
    Compound: Protein Cbln4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cbln4, LOC499947, rCG_40881
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h4cc_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h4cA (A:)
    lqhhhhhhhhasqndtepivlegkclvvcdsnpatdskgssssplgisvraanskvafsa
    vrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikvyqsqti
    qvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwqystfsg
    flvfpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4cA (A:)
    nskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvi
    kvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllgg
    wqystfsgflvfpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h4cB (B:)
    lqhhhhhhhhasqndtepivlegkclvvcdsnpatdskgssssplgisvraanskvafsa
    vrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikvyqsqti
    qvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwqystfsg
    flvfpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4cB (B:)
    anskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhv
    ikvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllg
    gwqystfsgflvfpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h4cC (C:)
    lqhhhhhhhhasqndtepivlegkclvvcdsnpatdskgssssplgisvraanskvafsa
    vrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikvyqsqti
    qvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwqystfsg
    flvfpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4cC (C:)
    anskvafsavrstnhemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikv
    yqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwq
    ystfsgflvfpl