PDB entry 5h4b

View 5h4b on RCSB PDB site
Description: Crystal structure of Cbln4
Class: protein binding
Keywords: Cbln1, Cbln4, C1q domain, C1q/TNF superfamily, neurexin, receptor specificity, synaptogenesis, PROTEIN BINDING
Deposited on 2016-10-31, released 2017-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cerebellin-4
    Species: Mus musculus [TaxId:10090]
    Gene: Cbln4, Cblnl1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h4ba_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h4bA (A:)
    lqhhhhhhhhasqndtepivlegkclvvcdsnpatdskgssssplgisvraanskvafsa
    vrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikvyqsqti
    qvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwqystfsg
    flvfpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4bA (A:)
    aanskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfh
    vikvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnll
    ggwqystfsgflvfpl