PDB entry 5h48

View 5h48 on RCSB PDB site
Description: Crystal structure of Cbln1
Class: protein binding
Keywords: C1q domain, C1q/TNF superfamily, receptor specificity, synaptogenesis, PROTEIN BINDING
Deposited on 2016-10-31, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cerebellin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CBLN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h48a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h48A (A:)
    gthhhhhhhhgsqnetepivlegkclvvcdsnptsdptgtalgisvrsgsakvafsairs
    tnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhvvkvynrqtiqv
    slmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmggwkystfsgfl
    vfpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h48A (A:)
    gsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfh
    vvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlm
    ggwkystfsgflvfpl