PDB entry 5h3h

View 5h3h on RCSB PDB site
Description: Esterase (EaEST) from Exiguobacterium antarcticum
Class: hydrolase
Keywords: perhydrolase, HYDROLASE
Deposited on 2016-10-24, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abhydrolase domain-containing protein
    Species: Exiguobacterium antarcticum (strain B7) [TaxId:1087448]
    Gene: Eab7_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h3ha_
  • Chain 'B':
    Compound: Abhydrolase domain-containing protein
    Species: Exiguobacterium antarcticum (strain B7) [TaxId:1087448]
    Gene: Eab7_1456
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h3hb_
  • Heterogens: F50, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h3hA (A:)
    mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
    ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
    gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
    svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
    evfeesghgmflderekftetlvsyvkssqtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h3hA (A:)
    mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
    ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
    gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
    svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
    evfeesghgmflderekftetlvsyvks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h3hB (B:)
    mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
    ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
    gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
    svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
    evfeesghgmflderekftetlvsyvkssqtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h3hB (B:)
    mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
    ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
    gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
    svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
    evfeesghgmflderekftetlvsyvkss