PDB entry 5h35

View 5h35 on RCSB PDB site
Description: Crystal structures of the TRIC trimeric intracellular cation channel orthologue from Sulfolobus solfataricus
Class: immune system/membrane protein
Keywords: ion channels, IMMUNE SYSTEM-MEMBRANE PROTEIN complex
Deposited on 2016-10-20, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H35
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H35 (0-End)
    Domains in SCOPe 2.07: d5h35b1, d5h35b2
  • Chain 'C':
    Compound: Membrane protein TRIC
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Membrane protein TRIC
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Membrane protein TRIC
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H35
  • Chain 'G':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H35 (0-End)
    Domains in SCOPe 2.07: d5h35g1, d5h35g2
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H35
  • Chain 'I':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H35 (0-End)
    Domains in SCOPe 2.07: d5h35i1, d5h35i2
  • Heterogens: GOL, NA, PX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h35B (B:)
    divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h35B (B:)
    divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5h35G (G:)
    divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h35G (G:)
    divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5h35I (I:)
    divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h35I (I:)
    divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn