PDB entry 5h20

View 5h20 on RCSB PDB site
Description: X-ray structure of PadR-like Transcription factor from bacteroid fragilis
Class: transcription regulator
Keywords: bacteroid fragilis, transcription factor, PadR, TRANSCRIPTION REGULATOR
Deposited on 2016-10-13, released 2017-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative PadR-family transcriptional regulatory protein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF9343_2549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5h20a_
  • Heterogens: PO4, GLC, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5h20A (A:)
mnvdnvksqmrkgmleycimlllhkepayasdiiqklkearlivvegtlyplltrlkndd
llsyewvestqgpprkyykltgkgesflgeleaswkelnetvnhianresi

    Sequence, based on observed residues (ATOM records): (download) 
    >5h20A (A:)
dnvksqmrkgmleycimlllhkepayasdiiqklkearlivvegtlyplltrlknddlls
yewvestqgpprkyykltgkgesflgeleaswkelnetvnhia