PDB entry 5h1z

View 5h1z on RCSB PDB site
Description: CYP153D17 from Sphingomonas sp. PAMC 26605
Class: hydrolase
Keywords: P450, Alkane Hydroxylase, CYP153D17, Sphingomonas sp. PAMC 26605, HYDROLASE
Deposited on 2016-10-13, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative CYP alkane hydroxylase CYP153D17
    Species: Sphingomonas sp. PAMC 26605 [TaxId:1112214]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H1Z
    Domains in SCOPe 2.07: d5h1za_
  • Heterogens: HEM, D12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h1zA (A:)
    atlaqdvidrfdvsrpelyrddlwqapfrelratapvhrvehsdfgpywsvssykpiitv
    eslpdlyssaggitladfiennptdvrmpmfiamdrpkhtgqrrtvapaftpsemvrmsd
    nirmrtaevldslewntpfdwvdtvsvelttqmlailfdfpweerrkltfwsdwagdiel
    vkneelrlerlrhmyecggyfqnlwnakigkpptpdlismmihsdamaemdqmeflgnli
    llivggndttrntmsavaygldlfpdqrakleadpsmipntvqeiirwqtplahmrrtat
    vdselegqqikagdklalwyisanrdesvfenadriivdrpnarrhlafghgihrcvgar
    laelqiavlleemakrrmrvnvlgepervaacfvhgyrklpveisry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h1zA (A:)
    vidrfdvsrpelyrddlwqapfrelratapvhrvehsdfgpywsvssykpiitveslpdl
    yssaggitladfiennptdvrmpmfiamdrpkhtgqrrtvapaftpsemvrmsdnirmrt
    aevldslewntpfdwvdtvsvelttqmlailfdfpweerrkltfwsdwagdielvkneel
    rlerlrhmyecggyfqnlwnakigkpptpdlismmihsdamaemdqmeflgnlillivgg
    ndttrntmsavaygldlfpdqrakleadpsmipntvqeiirwqtplahmrrtatvdsele
    gqqikagdklalwyisanrdesvfenadriivdrpnarrhlafghgihrcvgarlaelqi
    avlleemakrrmrvnvlgepervaacfvhgyrklpveisr