PDB entry 5h1y

View 5h1y on RCSB PDB site
Description: Crystal structure of the DDX41 DEAD domain in complex with SO42- and Mg2+
Class: hydrolase
Keywords: DNA sensor CDNs receptor ATPase, HYDROLASE
Deposited on 2016-10-13, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h1ya_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h1yb_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h1yA (A:)
    mhhhhhhssgvdlgtenlyfqsnlsmseerhervrkkyhilvegdgipppiksfkemkfp
    aailrglkkkgihhptpiqiqgiptilsgrdmigiaftgsgktlvftlpvimfcleqekr
    lpfskregpygliicpsrelarqthgileyycrllqedsspllrcalciggmsvkeqmet
    irhgvhmmvatpgrlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsyfkgqr
    qtllfsatmpkkiqnfaksalvkpvtinvgragaasldviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h1yA (A:)
    eerhervrkkyhilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptil
    sgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgi
    leyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsld
    icrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvti
    nv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h1yB (B:)
    mhhhhhhssgvdlgtenlyfqsnlsmseerhervrkkyhilvegdgipppiksfkemkfp
    aailrglkkkgihhptpiqiqgiptilsgrdmigiaftgsgktlvftlpvimfcleqekr
    lpfskregpygliicpsrelarqthgileyycrllqedsspllrcalciggmsvkeqmet
    irhgvhmmvatpgrlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsyfkgqr
    qtllfsatmpkkiqnfaksalvkpvtinvgragaasldviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h1yB (B:)
    smseerhervrkkyhilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgip
    tilsgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqt
    hgileyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmv
    sldicrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkp
    vtinv