PDB entry 5h0v

View 5h0v on RCSB PDB site
Description: Crystal structure of H88A mutated human transthyretin
Class: transport protein
Keywords: transthhyretin, amyloidosis, transporter, TRANSPORT PROTEIN
Deposited on 2016-10-07, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (9-End)
      • expression tag (7-8)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d5h0va1, d5h0va2
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (9-End)
      • expression tag (7-8)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d5h0vb1, d5h0vb2
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (9-End)
      • expression tag (7-8)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d5h0vc1, d5h0vc2
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (9-End)
      • expression tag (7-8)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d5h0vd1, d5h0vd2
  • Heterogens: MPD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h0vA (A:)
    ahhhhhhmsplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltte
    eefvegiykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttav
    vtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h0vA (A:)
    msplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h0vB (B:)
    ahhhhhhmsplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltte
    eefvegiykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttav
    vtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h0vB (B:)
    msplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h0vC (C:)
    ahhhhhhmsplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltte
    eefvegiykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttav
    vtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h0vC (C:)
    msplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h0vD (D:)
    ahhhhhhmsplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltte
    eefvegiykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttav
    vtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h0vD (D:)
    msplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtnp