PDB entry 5h07

View 5h07 on RCSB PDB site
Description: TNIP2-Ub complex, C2 form
Class: signaling protein
Keywords: coiled-coil, complex, signal transduction, SIGNALING PROTEIN
Deposited on 2016-10-04, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h07a1, d5h07a2, d5h07a3
  • Chain 'C':
    Compound: TNFAIP3-interacting protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TNIP2, ABIN2, FLIP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: TNFAIP3-interacting protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TNIP2, ABIN2, FLIP1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h07A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvka
    kiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h07A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvka
    kiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.