PDB entry 5gzn

View 5gzn on RCSB PDB site
Description: Structure of neutralizing antibody bound to Zika envelope protein
Class: viral protein/immune system
Keywords: Zika virus, human neutralizing antibody, envelope protein, molecular determinants, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2016-09-29, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzna1, d5gzna2
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gznb1, d5gznb2
  • Chain 'C':
    Compound: antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZN (0-End)
  • Chain 'D':
    Compound: Antibody Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZN (0-End)
    Domains in SCOPe 2.07: d5gznd1, d5gznd2
  • Chain 'E':
    Compound: Genome polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Genome polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZN (0-End)
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZN (0-End)
    Domains in SCOPe 2.07: d5gznl1, d5gznl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gznA (A:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gznA (A:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhndtghetdenrakveitpnspraeatlggfgs
    lgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvef
    kdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsy
    slctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvi
    testenskmmleldppfgdsyivigvgekkithhwhrsgsti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gznB (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gznB (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqndtghetdenrakveitpnspraeatlggfgsl
    gldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefk
    dahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsys
    lctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvit
    estenskmmleldppfgdsyivigvgekkithhwhrsgsti
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gznD (D:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydsnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsvwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gznD (D:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydsnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsvwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5gznL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydsnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsvwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gznL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydsnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsvwvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt