PDB entry 5gz0

View 5gz0 on RCSB PDB site
Description: Crystal structure of FM329, a recombinant Fab adopted from cetuximab
Class: immune system
Keywords: Antibody fragment, Recombinant Fab, Cetuximab, EGFR, IMMUNE SYSTEM
Deposited on 2016-09-26, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FM329 light chain
    Species: Homo sapiens/Mus musculus xenograft [TaxId:1383439]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZ0 (0-End)
    Domains in SCOPe 2.07: d5gz0a1, d5gz0a2
  • Chain 'B':
    Compound: FM329 heavy chain
    Species: Homo sapiens/Mus musculus xenograft [TaxId:1383439]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZ0 (0-End)
  • Chain 'C':
    Compound: FM329 light chain
    Species: Homo sapiens/Mus musculus xenograft [TaxId:1383439]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZ0 (0-End)
    Domains in SCOPe 2.07: d5gz0c1, d5gz0c2
  • Chain 'D':
    Compound: FM329 heavy chain
    Species: Homo sapiens/Mus musculus xenograft [TaxId:1383439]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZ0 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gz0A (A:)
    diqmtqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgaec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gz0A (A:)
    diqmtqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gz0C (C:)
    diqmtqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgaec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gz0C (C:)
    diqmtqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'D':
    No sequence available.