PDB entry 5gvr

View 5gvr on RCSB PDB site
Description: Crystal structure of the DDX41 DEAD domain in an apo closed form
Class: hydrolase
Keywords: ATPase, DEAD box protein, HYDROLASE
Deposited on 2016-09-06, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gvra_
  • Heterogens: LMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvrA (A:)
    ilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftg
    sgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgileyycrllqeds
    spllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadr
    midmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvtinvgrag