PDB entry 5gvq

View 5gvq on RCSB PDB site
Description: Solution structure of the first RRM domain of human spliceosomal protein SF3b49
Class: RNA binding protein
Keywords: RRM, SF3b49, SF3b145, U2 snRNP, RNA BINDING PROTEIN, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2016-09-06, released 2017-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3B subunit 4
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B4, SAP49
    Database cross-references and differences (RAF-indexed):
    • PDB 5GVQ (0-104)
    Domains in SCOPe 2.06: d5gvqa1, d5gvqa2, d5gvqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvqA (A:)
    gssgssgpisernqdatvyvggldekvsepllwelflqagpvvnthmpkdrvtgqhqgyg
    fveflseedadyaikimdmiklygkpirvnkasahnknlsgpssg