PDB entry 5gv8

View 5gv8 on RCSB PDB site
Description: Structure of NADH-cytochrome b5 reductase refined with the multipolar atomic model at 0.78A
Class: oxidoreductase
Keywords: Oxidoreductase, electron transfer, flavoprotein
Deposited on 2016-09-03, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 0.78 Å
R-factor: N/A
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-cytochrome b5 reductase 3
    Species: Sus scrofa [TaxId:9823]
    Gene: CYB5R3, DIA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gv8a1, d5gv8a2
  • Heterogens: FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gv8A (A:)
    stpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnl
    virpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngll
    vyqgkgkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfa
    nqtekdillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeep
    lvlmcgpppmiqyaclpnlervghpkercfaf