PDB entry 5gtl

View 5gtl on RCSB PDB site
Description: NADPH complex structure of Aldehyde Dehydrogenase from Bacillus cereus
Class: oxidoreductase
Keywords: Oxidoreductase, Aldehyde Dehydrogenase NAPDH-COMPLEX STRUCTURE NADPH ROSSMANN 2 FOLD
Deposited on 2016-08-21, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gtla_
  • Chain 'B':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gtlb_
  • Chain 'C':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gtlc_
  • Chain 'D':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gtld_
  • Heterogens: NA, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gtlA (A:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtlA (A:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gtlB (B:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtlB (B:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gtlC (C:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtlC (C:)
    elkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavkaa
    rsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatve
    nyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatgc
    tivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgst
    vtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsrv
    fvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatva
    aggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygla
    agvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnytev
    ksvwvnik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gtlD (D:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtlD (D:)
    ielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavka
    arsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatv
    enyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatg
    ctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgs
    tvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsr
    vfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatv
    aaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygl
    aagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyte
    vksvwvnik