PDB entry 5gta

View 5gta on RCSB PDB site
Description: 3D Crystal Structure of LsrB Bound to Furanosyl diester (R)-THMF, from Salmonella typhi
Class: signaling protein
Keywords: ABC Transporter, Salmonella typhi, AutoInducer-2, LuxS regulated, Two component system, SIGNALING PROTEIN
Deposited on 2016-08-19, released 2017-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding protein lsrB
    Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
    Gene: lsrB, STY3793, t3541
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gtaa_
  • Heterogens: PAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gtaA (A:)
    marhsikmialltafglasavmtvqaaeriafipklvgvgfftsggngaqeagkalgidv
    tydgptepsvsgqvqlvnnfvnqgydaiivsavspdglcpalkramqrgvkiltwdsdtk
    pecrsyyinqgtpkqlgsmlvemaahqvdkekakvaffyssptvtdqnqwvkeakakisq
    ehpgweivttqfgyndatkslqtaegiikaypdldaiiapdanalpaaaqaaenlkrnnl
    aivgfstpnvmrpyvqrgtvkefglwdvvqqgkisvyvanallknmpmnvgdsldipgig
    kvtvspnseqgyhyeakgngivllpervifnkdnidkydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtaA (A:)
    aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
    aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
    qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
    iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
    dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
    rvifnkdnidkydf