PDB entry 5gt6

View 5gt6 on RCSB PDB site
Description: Apo structure of Aldehyde Dehydrogenase from Bacillus cereus
Class: oxidoreductase
Keywords: Oxidoreductase, Aldehyde Dehydrogenase NAD+ NADP+
Deposited on 2016-08-18, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gt6a_
  • Chain 'B':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gt6b_
  • Chain 'C':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gt6c_
  • Chain 'D':
    Compound: Betaine-aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:1396]
    Gene: AT268_22120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gt6d_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gt6A (A:)
    mgsshhhhhhsqdpmlktnielkpkveaflneeikmfingefvsaiggktfetynpated
    vlavvceaqeedidaavkaarsafesgpwaemttaerahliykladlieehreelaqlea
    ldngkpyqvaldddisatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiip
    wnfplvmsswkmgaalatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpe
    agaaivnhhdidkvaftgstvtgkyimrqsaemikhvtlelggkspniiledadleeain
    gafqgimynhgqncsagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskk
    qqervlnyieqgkkegatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvl
    pfdsteevierannssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggy
    kqsgigrelgsyaldnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gt6A (A:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gt6B (B:)
    mgsshhhhhhsqdpmlktnielkpkveaflneeikmfingefvsaiggktfetynpated
    vlavvceaqeedidaavkaarsafesgpwaemttaerahliykladlieehreelaqlea
    ldngkpyqvaldddisatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiip
    wnfplvmsswkmgaalatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpe
    agaaivnhhdidkvaftgstvtgkyimrqsaemikhvtlelggkspniiledadleeain
    gafqgimynhgqncsagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskk
    qqervlnyieqgkkegatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvl
    pfdsteevierannssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggy
    kqsgigrelgsyaldnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gt6B (B:)
    ielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavka
    arsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatv
    enyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatg
    ctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgs
    tvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsr
    vfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatv
    aaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygl
    aagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyte
    vksvwvnik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gt6C (C:)
    mgsshhhhhhsqdpmlktnielkpkveaflneeikmfingefvsaiggktfetynpated
    vlavvceaqeedidaavkaarsafesgpwaemttaerahliykladlieehreelaqlea
    ldngkpyqvaldddisatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiip
    wnfplvmsswkmgaalatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpe
    agaaivnhhdidkvaftgstvtgkyimrqsaemikhvtlelggkspniiledadleeain
    gafqgimynhgqncsagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskk
    qqervlnyieqgkkegatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvl
    pfdsteevierannssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggy
    kqsgigrelgsyaldnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gt6C (C:)
    lkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavkaar
    safesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatven
    yryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatgct
    ivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgstv
    tgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsrvf
    vhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatvaa
    ggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssyglaa
    gvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnytevk
    svwvnik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gt6D (D:)
    mgsshhhhhhsqdpmlktnielkpkveaflneeikmfingefvsaiggktfetynpated
    vlavvceaqeedidaavkaarsafesgpwaemttaerahliykladlieehreelaqlea
    ldngkpyqvaldddisatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiip
    wnfplvmsswkmgaalatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpe
    agaaivnhhdidkvaftgstvtgkyimrqsaemikhvtlelggkspniiledadleeain
    gafqgimynhgqncsagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskk
    qqervlnyieqgkkegatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvl
    pfdsteevierannssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggy
    kqsgigrelgsyaldnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gt6D (D:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik