PDB entry 5gsz

View 5gsz on RCSB PDB site
Description: Crystal Structure of the KIF19A Motor Domain Complexed with Mg-ADP
Class: motor protein
Keywords: kinesin, motor domain, Mg-ADP, MOTOR PROTEIN
Deposited on 2016-08-18, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF19
    Species: Mus musculus [TaxId:10090]
    Gene: Kif19, Kif19a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsza_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gszA (A:)
    mkdsgdskdqqlmvalrvrpisvaeleegatliahkmdeqmvvlmdpmedpddilrahrs
    reksylfdvafdftatqemvyqattksliegvisgynatvfaygptgcgktytmlgtdhe
    pgiyvrtlndlfraieetsndmeyevsmsyleiynemirdllnpalgylelredskgviq
    vagitevstinakeimqllmkgnrqrtqeptaanqtssrshavlqvavrqrsrvknilqe
    vrqgrlfmidlagserasqtqnrgqrmkegahinrsllalgncinalsdkgsnkyinyrd
    skltrllkdslggnsrtvmiahispastafeesrntltyagraknirtrvkqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gszA (A:)
    qlmvalrvrpisvaeleegatliahkmdeqmvvlmdpmedpddilrahrsreksylfdva
    fdftatqemvyqattksliegvisgynatvfaygptgcgktytmlgtdhepgiyvrtlnd
    lfraieetsndmeyevsmsyleiynemirdllnpalgylelredsviqvagitevstina
    keimqllmkgnrqrtqeptqtssrshavlqvavrqrsrvknilqevrqgrlfmidlagse
    llalgncinalsdkgsnkyinyrdskltrllkdslggnsrtvmiahispastafeesrnt
    ltyagr