PDB entry 5gsu

View 5gsu on RCSB PDB site
Description: Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, Th2A and Th2B
Class: DNA binding protein/DNA
Keywords: Nucleosome, histone variants, testis-specific, Th2A, Th2B, DNA BINDING PROTEIN-DNA complex
Deposited on 2016-08-17, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsub_
  • Chain 'C':
    Compound: Histone H2A type 1-A
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2AA, H2AFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsuc_
  • Chain 'D':
    Compound: Histone H2B type 1-A
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2BA, TSH2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsud_
  • Chain 'E':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsuf_
  • Chain 'G':
    Compound: Histone H2A type 1-A
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2AA, H2AFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsug_
  • Chain 'H':
    Compound: Histone H2B type 1-A
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H2BA, TSH2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gsuh_
  • Chain 'I':
    Compound: DNA (146-mer)
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (146-mer)
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: CL, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gsuB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsuB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gsuC (C:)
    sgrgkqggkaraksksrssraglqfpvgrihrllrkgnyaerigagapvylaavleylta
    eilelagnasrdnkktriiprhlqlairndeelnkllggvtiaqggvlpniqavllpkkt
    eshhhkaqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsuC (C:)
    ksksrssraglqfpvgrihrllrkgnyaerigagapvylaavleyltaeilelagnasrd
    nkktriiprhlqlairndeelnkllggvtiaqggvlpniqavllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gsuD (D:)
    pevsskgatiskkgfkkavvktqkkegkkrkrtrkesysiyiykvlkqvhpdtgisskam
    simnsfvtdiferiaseasrlahyskrstissreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsuD (D:)
    rkrtrkesysiyiykvlkqvhpdtgisskamsimnsfvtdiferiaseasrlahyskrst
    issreiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gsuF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsuF (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gsuG (G:)
    sgrgkqggkaraksksrssraglqfpvgrihrllrkgnyaerigagapvylaavleylta
    eilelagnasrdnkktriiprhlqlairndeelnkllggvtiaqggvlpniqavllpkkt
    eshhhkaqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsuG (G:)
    sksrssraglqfpvgrihrllrkgnyaerigagapvylaavleyltaeilelagnasrdn
    kktriiprhlqlairndeelnkllggvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gsuH (H:)
    pevsskgatiskkgfkkavvktqkkegkkrkrtrkesysiyiykvlkqvhpdtgisskam
    simnsfvtdiferiaseasrlahyskrstissreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsuH (H:)
    trkesysiyiykvlkqvhpdtgisskamsimnsfvtdiferiaseasrlahyskrstiss
    reiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.