PDB entry 5gst

View 5gst on RCSB PDB site
Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
Deposited on 1993-07-20, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gstA (A:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gstB (B:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk