PDB entry 5gs1

View 5gs1 on RCSB PDB site
Description: Crystal structure of homo-specific diabody
Class: immune system
Keywords: diabody, antibody fragment, IMMUNE SYSTEM
Deposited on 2016-08-13, released 2016-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1 (0-End)
    Domains in SCOPe 2.06: d5gs1a_
  • Chain 'B':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
    Domains in SCOPe 2.06: d5gs1b_
  • Chain 'C':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'D':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'E':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'F':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'G':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
    Domains in SCOPe 2.06: d5gs1g1, d5gs1g2
  • Chain 'H':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
    Domains in SCOPe 2.06: d5gs1h1, d5gs1h2
  • Chain 'I':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'J':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'K':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'L':
    Compound: diabody
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
  • Chain 'M':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1 (0-End)
  • Chain 'N':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
    Domains in SCOPe 2.06: d5gs1n_
  • Chain 'O':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1 (0-End)
  • Chain 'P':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
    Domains in SCOPe 2.06: d5gs1p_
  • Chain 'Q':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1 (0-End)
    Domains in SCOPe 2.06: d5gs1q_
  • Chain 'R':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS1
    Domains in SCOPe 2.06: d5gs1r_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gs1A (A:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1A (A:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gs1B (B:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1B (B:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
    dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gs1G (G:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggsdivltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssra
    tgvparfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1G (G:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
    dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvsdiv
    ltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvparf
    sgsgsgtdftltisslepedfavyychqysdisptfgqgtkve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gs1H (H:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggsdivltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssra
    tgvparfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1H (H:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
    dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssdi
    vltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvpar
    fsgsgsgtdftltisslepedfavyychqysdisptfgqgtkve
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5gs1N (N:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1N (N:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
    dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5gs1P (P:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1P (P:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
    dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5gs1Q (Q:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1Q (Q:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkve
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5gs1R (R:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs1R (R:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
    dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss