PDB entry 5gqq

View 5gqq on RCSB PDB site
Description: Structure of ALG-2/HEBP2 Complex
Class: apoptosis
Keywords: EF Hands, complex, Calcium ions, APOPTOSIS
Deposited on 2016-08-08, released 2016-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HEBP2, C6orf34, SOUL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gqqa_
  • Chain 'B':
    Compound: Heme-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HEBP2, C6orf34, SOUL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gqqb_
  • Chain 'C':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75340 (2-169)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5gqqc1, d5gqqc2
  • Chain 'D':
    Compound: programmed cell death protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75340 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5gqqd1, d5gqqd2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gqqA (A:)
    vetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgknek
    emkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvfv
    rsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gqqB (B:)
    vetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgknek
    emkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvfv
    rsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gqqC (C:)
    gsdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvn
    fseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrq
    grgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gqqD (D:)
    gsdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvn
    fseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrq
    grgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gqqD (D:)
    gsdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvn
    fseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrq
    grgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf