PDB entry 5gpl

View 5gpl on RCSB PDB site
Description: Crystal structure of Ccp1
Class: chaperone
Keywords: Ccp1 dimer, nucleosome assembly protein, CHAPERONE
Deposited on 2016-08-03, released 2016-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative nucleosome assembly protein C36B7.08c
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: SPBC36B7.08c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gpla_
  • Chain 'B':
    Compound: Putative nucleosome assembly protein C36B7.08c
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: SPBC36B7.08c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gplb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gplA (A:)
    meaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagde
    isqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikee
    kakddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgat
    ltiflaedlfpnavkyfteamteeasdedesvdleedeeeedeedeegdeekqeppskks
    kksnaaaenlyfqgledykddddkhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gplA (A:)
    eaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagdei
    sqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikeek
    akddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgatl
    tiflaedlfpnavkyfteamteeasd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gplB (B:)
    meaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagde
    isqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikee
    kakddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgat
    ltiflaedlfpnavkyfteamteeasdedesvdleedeeeedeedeegdeekqeppskks
    kksnaaaenlyfqgledykddddkhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gplB (B:)
    eaaqafenlanleqefgkaeieilkkqnelfqplfeqrrdilktinnfwvvvleaagdei
    sqyitpedsvllekleniyverfnekeprdvrisltfqpneylqddnltlvkevrikeek
    akddeglekkitkytsqpvdihwkpgkslfrknkklppnffdyfqwtgeeedddfdgatl
    tiflaedlfpnavkyfteamteeasd