PDB entry 5gms

View 5gms on RCSB PDB site
Description: Crystal structure of the mutant S202W/I203F of the esterase E40
Class: hydrolase
Keywords: esterase, hydrolase
Deposited on 2016-07-15, released 2017-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6WGE1 (16-312)
      • engineered mutation (217-218)
    Domains in SCOPe 2.06: d5gmsa_
  • Chain 'B':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6WGE1 (16-312)
      • engineered mutation (217-218)
    Domains in SCOPe 2.06: d5gmsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gmsA (A:)
    hhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmplddd
    iqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlg
    ldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalryigep
    lpaagvclspwidmeatgesfttnatmdpsvnkervmwfaalylggknpqaplasplyad
    lqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpegkqa
    iarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmsA (A:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gmsB (B:)
    hhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmplddd
    iqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlg
    ldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalryigep
    lpaagvclspwidmeatgesfttnatmdpsvnkervmwfaalylggknpqaplasplyad
    lqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpegkqa
    iarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmsB (B:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig