PDB entry 5gmr

View 5gmr on RCSB PDB site
Description: Crystal structure of the mutant M3+S202W/I203F of the esterase E40
Class: hydrolase
Keywords: esterase, hydrolase
Deposited on 2016-07-15, released 2017-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6WGE1 (Start-314)
      • see sequence details (37)
      • see sequence details (39-41)
      • engineered mutation (219-220)
    Domains in SCOPe 2.06: d5gmra_
  • Chain 'B':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6WGE1 (Start-314)
      • see sequence details (37)
      • see sequence details (39-41)
      • engineered mutation (219-220)
    Domains in SCOPe 2.06: d5gmrb_
  • Chain 'C':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6WGE1 (Start-314)
      • see sequence details (37)
      • see sequence details (39-41)
      • engineered mutation (219-220)
    Domains in SCOPe 2.06: d5gmrc_
  • Chain 'D':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6WGE1 (Start-314)
      • see sequence details (37)
      • see sequence details (39-41)
      • engineered mutation (219-220)
    Domains in SCOPe 2.06: d5gmrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gmrA (A:)
    hhhhhhssglvprgshmakspeldrvigmireraatpykhlstdddrrlyetmlgsmpld
    ddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagcrv
    lgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalryig
    eplpaagvclspwidmeatgesfttnatmdpsvnkervmwfaalylggknpqaplasply
    adlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpegk
    qaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmrA (A:)
    kspeldrvigmireraatpykhlstdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gmrB (B:)
    hhhhhhssglvprgshmakspeldrvigmireraatpykhlstdddrrlyetmlgsmpld
    ddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagcrv
    lgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalryig
    eplpaagvclspwidmeatgesfttnatmdpsvnkervmwfaalylggknpqaplasply
    adlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpegk
    qaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmrB (B:)
    kspeldrvigmireraatpykhlstdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gmrC (C:)
    hhhhhhssglvprgshmakspeldrvigmireraatpykhlstdddrrlyetmlgsmpld
    ddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagcrv
    lgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalryig
    eplpaagvclspwidmeatgesfttnatmdpsvnkervmwfaalylggknpqaplasply
    adlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpegk
    qaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmrC (C:)
    kspeldrvigmireraatpykhlstdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gmrD (D:)
    hhhhhhssglvprgshmakspeldrvigmireraatpykhlstdddrrlyetmlgsmpld
    ddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagcrv
    lgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalryig
    eplpaagvclspwidmeatgesfttnatmdpsvnkervmwfaalylggknpqaplasply
    adlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpegk
    qaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmrD (D:)
    kspeldrvigmireraatpykhlstdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig