PDB entry 5gmq

View 5gmq on RCSB PDB site
Description: Structure of MERS-CoV RBD in complex with a fully human antibody MCA1
Class: viral protein/immune system
Keywords: VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2016-07-15, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s protein
    Species: Middle East respiratory syndrome coronavirus [TaxId:1335626]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MCA1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GMQ (0-End)
  • Chain 'C':
    Compound: MCA1 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GMQ (0-End)
    Domains in SCOPe 2.07: d5gmqc1, d5gmqc2
  • Heterogens: NAG, MAN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gmqC (C:)
    dveltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmqC (C:)
    dveltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdlqsgnsqesvteqdskdstyslsstltl
    skadyekhkyacevthqglsspvtksfnr