PDB entry 5gmm

View 5gmm on RCSB PDB site
Description: Crystal structure of human Carbonic anhydrase I in complex with polmacoxib
Class: lyase
Keywords: Lyase, Inhibitor, Complex
Deposited on 2016-07-14, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gmma_
  • Chain 'B':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gmmb_
  • Heterogens: ZN, 949, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gmmA (A:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmmA (A:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gmmB (B:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmmB (B:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf