PDB entry 5gks

View 5gks on RCSB PDB site
Description: Crystal structure of SLE patient-derived anti-DNA antibody
Class: immune system
Keywords: antibody, lupus, Fab, IMMUNE SYSTEM
Deposited on 2016-07-05, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IgG2, Fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GKS
  • Chain 'B':
    Compound: lambda, Fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GKS
    Domains in SCOPe 2.07: d5gksb1, d5gksb2
  • Chain 'C':
    Compound: IgG2, Fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GKS
  • Chain 'D':
    Compound: lambda, Fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GKS
    Domains in SCOPe 2.07: d5gksd1, d5gksd2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gksB (B:)
    qsaltqprsvsgspgqsvtisctgtssdvggynyvswyqqhpgkapkvmiydvskrpsgv
    pdrfsgsksgntasltisglqaedeadyyccsyagsytyvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gksB (B:)
    saltqprsvsgspgqsvtisctgtssdvggynyvswyqqhpgkapkvmiydvskrpsgvp
    drfsgsksgntasltisglqaedeadyyccsyagsytyvfgtgtkvtvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gksD (D:)
    qsaltqprsvsgspgqsvtisctgtssdvggynyvswyqqhpgkapkvmiydvskrpsgv
    pdrfsgsksgntasltisglqaedeadyyccsyagsytyvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gksD (D:)
    saltqprsvsgspgqsvtisctgtssdvggynyvswyqqhpgkapkvmiydvskrpsgvp
    drfsgsksgntasltisglqaedeadyyccsyagsytyvfgtgtkvtvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqnkyaassyls
    ltpeqwkshrsyscqvthegstvektvap