PDB entry 5gjt

View 5gjt on RCSB PDB site
Description: Crystal structure of H1 hemagglutinin from A/Washington/05/2011 in complex with a neutralizing antibody 3E1
Class: immune system
Keywords: epitope, Fab, complementarity determining region, paratope, IMMUNE SYSTEM
Deposited on 2016-07-01, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1318439]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot N0C8E5 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5gjta1, d5gjta2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1318439]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gjtb_
  • Chain 'H':
    Compound: heavy chain of human neutralizing antibody 3E1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GJT (0-End)
  • Chain 'L':
    Compound: light chain of human neutralizing antibody 3E1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GJT (0-End)
    Domains in SCOPe 2.07: d5gjtl1, d5gjtl2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gjtA (A:)
    gsdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gjtA (A:)
    sdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagakgfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpsttadqqslyqnadtyvfvgtsryskkfkpeiairpkvrdqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitig
    kcpkyvkstklrlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gjtB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrnqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidgvlelv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gjtB (B:)
    aiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmntqft
    avgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrn
    qlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5gjtL (L:)
    diqmtqspatlsasvgdrvsitcrasqsisswlawyqqkpgkapklliykasslesgvps
    rfsgsgsgseftltisslqpddfaiyycqqynsypwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gjtL (L:)
    diqmtqspatlsasvgdrvsitcrasqsisswlawyqqkpgkapklliykasslesgvps
    rfsgsgsgseftltisslqpddfaiyycqqynsypwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    skadyekhkvyacevthqglsspvtksfnrg