PDB entry 5gjl

View 5gjl on RCSB PDB site
Description: Solution structure of SUMO from Plasmodium falciparum
Class: protein binding
Keywords: sumo, protein binding
Deposited on 2016-06-30, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Plasmodium falciparum (isolate Dd2) [TaxId:57267]
    Gene: PFDG_04583
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gjla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gjlA (A:)
    mgdddsavnnngsspvnnqgehiqvkvrspdgaevffkikrktkleklmevycnrlgqsm
    eavrflydgdrihgdntpeqlgiedgdvidamvqqtgg