PDB entry 5gj3

View 5gj3 on RCSB PDB site
Description: Periplasmic heme-binding protein RhuT from Roseiflexus sp. RS-1 in two-heme bound form (holo-2)
Class: transport protein
Keywords: metal transport, TRANSPORT PROTEIN
Deposited on 2016-06-26, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic binding protein
    Species: Roseiflexus sp. RS-1 [TaxId:357808]
    Gene: RoseRS_3565
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5UZ69 (5-269)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d5gj3a1, d5gj3a2
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj3A (A:)
    gplgserivslngditeiifalgmgeyvvgvdssatyppertkmlpnigyqrrlsaegil
    slnptlvigdeaagppetlaqiraagvplaitadppsldapqqkirfvaqalgipqrger
    laaqveaeiaaardlarritnpphvlflylrgtdvqqvagrntavdvmiaaagginaaad
    agivefkplspevviaaqpdvllvldkglesvggvdgllkipgladtpagrqrriialdd
    lyllgmgprtgqaltdltiafydaaqgsrp