PDB entry 5giz

View 5giz on RCSB PDB site
Description: Periplasmic heme-binding protein BhuT in apo form
Class: transport protein
Keywords: metal transport, TRANSPORT PROTEIN
Deposited on 2016-06-26, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hemin transport system, substrate-binding protein
    Species: Burkholderia cenocepacia J2315 [TaxId:216591]
    Gene: hmuT
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EKB3 (5-270)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d5giza1, d5giza2
  • Chain 'B':
    Compound: Putative hemin transport system, substrate-binding protein
    Species: Burkholderia cenocepacia J2315 [TaxId:216591]
    Gene: hmuT
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EKB3 (5-270)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d5gizb1, d5gizb2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gizA (A:)
    gplgskrviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsae
    gllslrpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrda
    gaallqrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryag
    arnamqgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrv
    vsldalfllgfgprlplavttlhrrlsdala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gizB (B:)
    gplgskrviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsae
    gllslrpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrda
    gaallqrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryag
    arnamqgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrv
    vsldalfllgfgprlplavttlhrrlsdala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gizB (B:)
    gskrviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsaegll
    slrpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrdagaa
    llqrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryagarn
    amqgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrvvsl
    dalfllgfgprlplavttlhrrlsdala